GCNA Polyclonal antibody

• 

  WB analysis using 30693-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30693-1-AP (ACRC antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30693-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30693-1-AP (GCNA antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

GCNA Polyclonal Antibody for WB, ELISA

Cat No. 30693-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

acidic repeat containing, ACRC, GCNA, NAAR1

---

Tested Applications

• Positive WB detected in: LNCaP cells, PC-3 cells, SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30693-1-AP targets GCNA in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33720

  Product name: Recombinant human ACRC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-137 aa of BC136259

  Sequence: MDGCKKELPRLQEPEEDEDCYILNVQSSSDDTSGSSVARRAPKRQASCILNVQSRSGDTSGSSVARRAPKRQASSVVVIDSDSDEECHTHEEKKAKLLEINSDDESPECCHVKPAIQEPPIVISDDDNDDDNGNDLE

• Full Name: acidic repeat containing
• Calculated Molecular Weight: 691 aa, 76 kDa
• Observed Molecular Weight: 76 kDa
• GenBank Accession Number: BC136259
• Gene Symbol: GCNA
• Gene ID (NCBI): 93953
• RRID: AB_3086389
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96QF7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Germ cell nuclear acidic protein (GCNA) has been extensively used as a germ cell marker for almost 30 years. Recently, mutations in GCNA have been linked to azoospermia in humans, defining GCNA as a clinical determinant of human infertility.