GCSH Recombinant monoclonal antibody

• 

  WB analysis of HEK-293 using 83012-5-RR

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 83012-5-RR (GCSH antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 83012-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83012-5-RR (GCSH antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 83012-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83012-5-RR against Human GCSH were performed. The affinity constant is below 1 pM.

GCSH Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83012-5-RR

Clone No.230505A3

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

GCE, GCSH, NKH

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MCF-7 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83012-5-RR targets GCSH in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10174

  Product name: Recombinant human GCSH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-173 aa of BC000790

  Sequence: MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE

• Full Name: glycine cleavage system protein H (aminomethyl carrier)
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: ~15 kDa
• GenBank Accession Number: BC000790
• Gene Symbol: GCSH
• Gene ID (NCBI): 2653
• RRID: AB_3670756
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P23434
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GCSH(Glycine cleavage system H protein, mitochondrial) is a component of the glycine cleavage system loosely associated with the mitochondrial inner membrane and has lipoic acid as a prosthetic group. The full-length GCSH cDNA encodes a precursor protein of 173 amino acids and a mature protein of 125 amino acids. The lipoylation of H-protein occurs in mitochondria which probably contain an activated form of lipoic acid as well as other components required for the transfer of lipoic acid to the protein(PMID:2211640). Defects in GCSH are a cause of non-ketotic hyperglycinemia (NKH).