GDAP1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68083-1-Ig (same clone as 68083-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68083-1-Ig (GDAP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 68083-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 68083-1-Ig (same clone as 68083-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 68083-1-Ig (GDAP1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68083-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 68083-1-Ig (same clone as 68083-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 68083-1-Ig (GDAP1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68083-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 68083-1-Ig (same clone as 68083-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using GDAP1 antibody (68083-1-Ig, Clone: 3E10D4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68083-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 68083-1-Ig (same clone as 68083-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using GDAP1 antibody (68083-1-Ig, Clone: 3E10D4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68083-1-PBS in a different storage buffer formulation.

GDAP1 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 68083-1-PBS

Clone No.3E10D4

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat, rabbit, pig

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

CMTRIA, GDAP1

---

Product Information

68083-1-PBS targets GDAP1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, mouse, rat, rabbit, pig samples.

• Tested Reactivity: Human, mouse, rat, rabbit, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28616

  Product name: Recombinant human GDAP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-257 aa of BC024939

  Sequence: MRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGTTLV

• Full Name: ganglioside-induced differentiation-associated protein 1
• Calculated Molecular Weight: 358 aa, 41 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC024939
• Gene Symbol: GDAP1
• Gene ID (NCBI): 54332
• RRID: AB_2918820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TB36
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GDAP1 is a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy.