GDF1 Polyclonal antibody

• 

  WB analysis using 28345-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28345-1-AP (GDF1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

GDF1 Polyclonal Antibody for WB, ELISA

Cat No. 28345-1-AP

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Synonyms

GDF 1, GDF1

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28345-1-AP targets GDF1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28831

  Product name: Recombinant human GDF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 65-273 aa of NM_001492

  Sequence: LFRRRDPQETRSGSRRTSPGVTLQPCHVEELGVAGNIVRHIPDRGAPTRASEPASAAGHCPEWTVVFDLSAVEPAERPSRARLELRFAAAAAAAPEGGWELSVAQAGQGAGADPGPVLLRQLVPALGPPVRAELLGAAWARNASWPRSLRLALALRPRAPAACARLAEASLLLVTLDPRLCHPLARPRRDAEPVLGGGPGGACRARRLY

• Full Name: growth differentiation factor 1
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: NM_001492
• Gene Symbol: GDF1
• Gene ID (NCBI): 2657
• RRID: AB_3086045
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27539
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GDF1 is a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. Studies in rodents suggest that this protein is involved in the establishment of left-right asymmetry in early embryogenesis and in neural development in later embryogenesis.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

MALLIKARJUNA (Verified Customer) (10-24-2025)

best for WB

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: liver tissue

FH

MALLIKARJUNA (Verified Customer) (10-24-2025)

best for western blot

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: liver tissue