GEN1 Monoclonal antibody, PBS Only

• 

  WB analysis of U2OS using 68060-1-Ig (same clone as 68060-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 68060-1-Ig (GEN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68060-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 68060-1-Ig (same clone as 68060-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 68060-1-Ig (GEN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68060-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68060-1-Ig (same clone as 68060-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68060-1-Ig (GEN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68060-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 68060-1-Ig (same clone as 68060-1-PBS)

  WB result of GEN1 antibody (68060-1-Ig; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-GEN1 transfected A549 cells. This data was developed using the same antibody clone with 68060-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GEN1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68060-1-PBS

Clone No.1A10D10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Gen, 1A10D10

---

Product Information

68060-1-PBS targets GEN1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31247

  Product name: Recombinant human GEN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 730-908 aa of NM_182625

  Sequence: NESRDSKILKGDQLLQEDYKVNTSVPYSVSNTVVKTCNVRPPNTALDHSRKVDMQTTRKILMKKSVCLDRHSSDEQSAPVFGKAKYTTQRMKHSSQKHNSSHFKESGHNKLSSPKIHIKETEQCVRSYETAENEESCFPDSTKSSLSSLQCHKKENNSGTCLDSPLPLRQRLKLRFQST

• Full Name: Gen homolog 1, endonuclease (Drosophila)
• Calculated Molecular Weight: 103 kDa
• Observed Molecular Weight: 98-100 kDa
• GenBank Accession Number: NM_182625
• Gene Symbol: GEN1
• Gene ID (NCBI): 348654
• RRID: AB_2918801
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q17RS7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GEN1 is a endonuclease which resolves Holliday junctions (HJs) by the introduction of symmetrically related cuts across the junction point, to produce nicked duplex products in which the nicks can be readily ligated. GEN1 efficiently cleaves both single and double HJs contained within large recombination intermediates.