GFOD1 Polyclonal antibody

• 

  WB analysis using 32902-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32902-1-AP (GFOD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

GFOD1 Polyclonal Antibody for WB, ELISA

Cat No. 32902-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

C6orf114, EC:1.-.-.-, Glucose-fructose oxidoreductase domain-containing protein 1

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32902-1-AP targets GFOD1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37656

  Product name: Recombinant human GFOD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 272-390 aa of BC119005

  Sequence: APEQELLVQDATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC

• Full Name: glucose-fructose oxidoreductase domain containing 1
• Calculated Molecular Weight: 390 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC119005
• Gene Symbol: GFOD1
• Gene ID (NCBI): 54438
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NXC2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glucose-fructose oxidoreductase domain 1 (GFOD1), may be linked to the development of ADHD. It plays a role in regulating oxidative stress in ADHD. GFOD1 may contribute to increased levels of oxidative stress specifically in the prefrontal cortex and cerebellar cortex regions and astrocytes affected by ADHD via up-regulation of the NF-κB p65/NOX2/oxidative stress axis (PMID: 40210145). There is a signal peptide at the N-terminal of this protein and the detected double strand in fetal human brain tissue is consistent with PMID: 38946427.