GHR Recombinant monoclonal antibody, PBS Only

• 

GHR Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85437-1-PBS

Clone No.242896B8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

GH binding protein, GH receptor, GHBP, Growth hormone-binding protein, Serum binding protein

---

Product Information

85437-1-PBS targets GHR in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3027

  Product name: Recombinant Human GHR protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-264 aa of NM_000163.5

  Sequence: AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY

• Full Name: GH binding protein
• Calculated Molecular Weight: 72 kDa
• GenBank Accession Number: NM_000163.5
• Gene Symbol: GHR
• Gene ID (NCBI): 2690
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10912-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.