GJB3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GJB3 Polyclonal antibody (12880-1-AP)

• Featured Product
• KD/KO Validated

GJB3 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 12880-1-AP Copied!

Publications (18)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

Connexin 31, Connexin-31, CX31, DFNA2, DFNA2B

• 

  WB analysis of HeLa using 12880-1-AP

  WB result of GJB3 antibody (12880-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GJB3 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse ovary using 12880-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 12880-1-AP (GJB3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12880-1-AP

  mouse stomach tissue was subjected to SDS PAGE followed by western blot with 12880-1-AP (GJB3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12880-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12880-1-AP (GJB3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12880-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12880-1-AP (GJB3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 12880-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12880-1-AP (GJB3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 12880-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 12880-1-AP (GJB3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 12880-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12880-1-AP (GJB3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 12880-1-AP

  IP result of anti-GJB3 (IP:12880-1-AP, 4ug; Detection:12880-1-AP 1:500) with HeLa cells lysate 2600 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervix using 12880-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervix tissue slide using 12880-1-AP (GJB3 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervix using 12880-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervix tissue slide using 12880-1-AP (GJB3 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse placenta using 12880-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 12880-1-AP (GJB3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse placenta using 12880-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 12880-1-AP (GJB3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 12880-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 12880-1-AP (GJB3 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 12880-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 12880-1-AP (GJB3 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 12880-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 12880-1-AP (GJB3 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human placenta using 12880-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using GJB3 antibody (12880-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GJB3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse stomach tissue, HeLa cells, mouse bladder tissue, mouse ovary tissue, mouse skin tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse placenta tissue, human ovary tumor tissue, human cervix tissue, human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12880-1-AP targets GJB3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, monkey, marmoset
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3839

  Product name: Recombinant human GJB3 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 101-270 aa of BC012918

  Sequence: RERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIVLTICELCYLICHRVLRGLHKDKPRGGCSPSSSASRASTCRCHHKLVEAGEVDPDPGNNKLQASAPNLTPI

• Full Name: gap junction protein, beta 3, 31kDa
• Calculated Molecular Weight: 270 aa, 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC012918
• Gene Symbol: GJB3
• Gene ID (NCBI): 2707
• RRID: AB_2110907
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75712
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GJB3, also known as Connexin-31 (Cx31), belongs to the connexin family. Connexins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. Mutations in the gene of GJB3 have been described in patients with dominant and recessive hearing impairment and in patients with erythrokeratodermia variabilis (EKV).

Publications

What published studies show

The GJB3 Polyclonal antibody (Cat# 12880-1-AP) has accumulated 18 citations across journals including Nature Communications, Science Translational Medicine, Cell Reports, Cancer Letters, Frontiers in Immunology, International Journal of Molecular Sciences, Scientific Reports, Stem Cells, Journal of Neuroscience, eLife, and others. Associated research fields include breast, colorectal, pancreatic, and lung cancers; cochlear function and hearing loss; placental development; intervertebral disc degeneration; endometriosis; and gap junction channel biology.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Nat Commun; Tumor cell-adipocyte gap junctions activate lipolysis and contribute to breast tumorigenesis; Authors - Jeremy Williams
mouse,human	WB,IHC	Sci Transl Med; Connexins orchestrate progression of breast cancer metastasis to the brain by promoting FAK activation; Authors - Girieca Lorusso
mouse	IF	J Nanobiotechnology; Atosiban-conjugated 3WJ-pRNA nanoparticles delivering GAS1-enhanced extracellular vesicles: targeting the decidua to combat recurrent miscarriage.; Authors - Yuan-Xing Li
human	IHC	Cancer Lett; Liver metastasis or peritoneal metastasis: single-cell RNA sequencing reveals the organotropism in colorectal cancer is driven by distinct partial-EMT processes; Authors - Chengxuan Yu
human	WB	Cell Rep; Cochlear Cell Modeling Using Disease-Specific iPSCs Unveils a Degenerative Phenotype and Suggests Treatments for Congenital Progressive Hearing Loss.; Authors - Makoto Hosoya
mouse,human	WB,IHC	Front Immunol; GJB3 promotes pancreatic cancer liver metastasis by enhancing the polarization and survival of neutrophil; Authors - Yanmiao Huo ; KD Validated