GJB5 Polyclonal antibody, PBS Only

• 

  IP experiment of mouse skin using 27166-1-AP (same clone as 27166-1-PBS)

  IP result of anti-GJB5 (IP:27166-1-AP, 4ug; Detection:27166-1-AP 1:300) with mouse skin tissue lysate 640 ug. This data was developed using the same antibody clone with 27166-1-PBS in a different storage buffer formulation.

GJB5 Polyclonal Antibody for IP, Indirect ELISA

Cat No. 27166-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IP, Indirect ELISA

Synonyms

---

Product Information

27166-1-PBS targets GJB5 in IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26052

  Product name: Recombinant human GJB5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 211-273 aa of BC004379

  Sequence: KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLLPDRPRDHVKKTIL

• Full Name: gap junction protein, beta 5, 31.1kDa
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC004379
• Gene Symbol: GJB5
• Gene ID (NCBI): 2709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95377
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GJB5, also known as Connexin31.1, is a connexin subtype associated with apoptosis in organs such as the eye and ovary; it is not highly expressed in many tissues in normal conditions (PMID:32592185).