GJB6 Polyclonal antibody

• 

  IHC staining of human oesophagus using 24215-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 24215-1-AP (GJB6 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human oesophagus using 24215-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 24215-1-AP (GJB6 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human skin cancer using 24215-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 24215-1-AP (GJB6 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skin cancer using 24215-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 24215-1-AP (GJB6 Antibody) at dilution of 1:50 (under 40x lens).

GJB6 Polyclonal Antibody for IHC, ELISA

Cat No. 24215-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

Connexin 30, CX30, DFNA3, DFNA3B, DFNB1B, ED2, EDH, Gap junction beta 6 protein, GJB6, HED

---

Tested Applications

• Positive IHC detected in: human oesophagus tissue, human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24215-1-AP targets GJB6 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21529

  Product name: Recombinant human GJB6 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 182-261 aa of BC038934

  Sequence: ISRPTEKTVFTIFMISASVICMLLNVAELCYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFPS

• Full Name: gap junction protein, beta 6, 30kDa
• Calculated Molecular Weight: 261 aa, 30 kDa
• GenBank Accession Number: BC038934
• Gene Symbol: GJB6
• Gene ID (NCBI): 10804
• RRID: AB_2879461
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O95452
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Gap junctions form conduits between adjacent cells that are composed of connexin protein subunits and provide direct intercellular communication pathways allowing rapid exchange of ions and metabolites (PMID: 12126230; 15094343). Connexins are four-pass transmembrane proteins with amino- and carboxy-terminal regions facing the cytoplasm. A connexon is composed of a hexamer of connexins. GJB6 (gap junction beta-6 protein, also known as connexin-30) is a member of the connexin family of proteins. GJB6 is a component of the gap junction networks of the cochlea.