Tested Applications
Positive IHC detected in | human oesophagus tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24215-1-AP targets GJB6 in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21529 Product name: Recombinant human GJB6 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 182-261 aa of BC038934 Sequence: ISRPTEKTVFTIFMISASVICMLLNVAELCYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFPS Predict reactive species |
Full Name | gap junction protein, beta 6, 30kDa |
Calculated Molecular Weight | 261 aa, 30 kDa |
GenBank Accession Number | BC038934 |
Gene Symbol | GJB6 |
Gene ID (NCBI) | 10804 |
RRID | AB_2879461 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | O95452 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Gap junctions form conduits between adjacent cells that are composed of connexin protein subunits and provide direct intercellular communication pathways allowing rapid exchange of ions and metabolites (PMID: 12126230; 15094343). Connexins are four-pass transmembrane proteins with amino- and carboxy-terminal regions facing the cytoplasm. A connexon is composed of a hexamer of connexins. GJB6 (gap junction beta-6 protein, also known as connexin-30) is a member of the connexin family of proteins. GJB6 is a component of the gap junction networks of the cochlea.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for GJB6 antibody 24215-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |