Glycerokinase Polyclonal antibody

Glycerokinase Polyclonal Antibody for WB, IF/ICC, IP, ELISA
Cat No. 13360-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, RIP, ELISA

GK, GKD, GK1, EC:2.7.1.30, ATP:glycerol 3-phosphotransferase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, mouse kidney tissue, mouse liver tissue, mouse testis tissue
Positive IP detected inHepG2 cells
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13360-1-AP targets Glycerokinase in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4175

Product name: Recombinant human GK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-357 aa of BC037549

Sequence: MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYG

Predict reactive species
Full Name glycerol kinase
Calculated Molecular Weight 524 aa, 57 kDa
Observed Molecular Weight 60-65 kDa
GenBank Accession NumberBC037549
Gene Symbol Glycerokinase
Gene ID (NCBI) 2710
RRIDAB_1167391
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP32189
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for Glycerokinase antibody 13360-1-APDownload protocol
IP protocol for Glycerokinase antibody 13360-1-APDownload protocol
WB protocol for Glycerokinase antibody 13360-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

J Ethnopharmacol

Si-Ni-San promotes liver regeneration by maintaining hepatic oxidative equilibrium and glucose/lipid metabolism homeostasis

Authors - Xu Yang
pigWB

Front Cell Dev Biol

Comparative Proteomics and Phosphoproteomics Analysis Reveal the Possible Breed Difference in Yorkshire and Duroc Boar Spermatozoa.

Authors - Yongjie Xu
mouseWB

J Appl Toxicol

Aberrant expression of miR-451a contributes to 1,2-dichloroethane-induced hepatic glycerol gluconeogenesis disorder by inhibiting glycerol kinase expression in NIH Swiss mice.

Authors - Ni Zeng
humanWB

Life Sci Alliance

Serine palmitoyltransferase assembles at ER-mitochondria contact sites.

Authors - Mari J Aaltonen
human,mouseIHC

J Adv Res

O-GlcNAc modification mediates aquaporin 3 to coordinate endometrial cell glycolysis and affects embryo implantation.

Authors - Hongshuo Zhang
human,mouseWB,IHC

Mol Metab

The GCKR-P446L gene variant predisposes to raised blood cholesterol and lower blood glucose in the P446L mouse-a model for GCKR rs1260326

Authors - Brian E Ford
Loading...
||
New chat Able
正在加载,请稍候...