Glycerokinase Polyclonal antibody

• 

  WB analysis of HepG2 using 13360-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13360-1-AP (Glycerokinase antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 13360-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13360-1-AP (Glycerokinase antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 13360-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 13360-1-AP (Glycerokinase antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 13360-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13360-1-AP (Glycerokinase antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 13360-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13360-1-AP (Glycerokinase antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 13360-1-AP

  IP result of anti-Glycerokinase (IP:13360-1-AP, 4ug; Detection:13360-1-AP 1:1000) with HepG2 cells lysate 4000ug.

• 

  IF Staining of HepG2 using 13360-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Glycerokinase antibody (13360-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HepG2 using 13360-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Glycerokinase antibody (13360-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

Glycerokinase Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 13360-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, RIP, ELISA

Synonyms

GK, GKD, GK1, EC:2.7.1.30, ATP:glycerol 3-phosphotransferase

---

Tested Applications

• Positive WB detected in: HepG2 cells, mouse kidney tissue, mouse liver tissue, mouse testis tissue
• Positive IP detected in: HepG2 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 9 publications below
• IHC: See 2 publications below
• IF: See 1 publications below
• RIP: See 1 publications below

Product Information

13360-1-AP targets Glycerokinase in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4175

  Product name: Recombinant human GK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-357 aa of BC037549

  Sequence: MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYG

• Full Name: glycerol kinase
• Calculated Molecular Weight: 524 aa, 57 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC037549
• Gene Symbol: Glycerokinase
• Gene ID (NCBI): 2710
• RRID: AB_1167391
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32189
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Ethnopharmacol; Si-Ni-San promotes liver regeneration by maintaining hepatic oxidative equilibrium and glucose/lipid metabolism homeostasis; Authors - Xu Yang
pig	WB	Front Cell Dev Biol; Comparative Proteomics and Phosphoproteomics Analysis Reveal the Possible Breed Difference in Yorkshire and Duroc Boar Spermatozoa.; Authors - Yongjie Xu
mouse	WB	J Appl Toxicol; Aberrant expression of miR-451a contributes to 1,2-dichloroethane-induced hepatic glycerol gluconeogenesis disorder by inhibiting glycerol kinase expression in NIH Swiss mice.; Authors - Ni Zeng
human	WB	Life Sci Alliance; Serine palmitoyltransferase assembles at ER-mitochondria contact sites.; Authors - Mari J Aaltonen
human,mouse	IHC	J Adv Res; O-GlcNAc modification mediates aquaporin 3 to coordinate endometrial cell glycolysis and affects embryo implantation.; Authors - Hongshuo Zhang
human,mouse	WB,IHC	Mol Metab; The GCKR-P446L gene variant predisposes to raised blood cholesterol and lower blood glucose in the P446L mouse-a model for GCKR rs1260326; Authors - Brian E Ford