GK3P Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 14176-1-AP (same clone as 14176-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 14176-1-AP (GK3P antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14176-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 14176-1-AP (same clone as 14176-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 14176-1-AP (GK3P antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14176-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 14176-1-AP (same clone as 14176-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer using 14176-1-AP (GK3P antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 14176-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 14176-1-AP (same clone as 14176-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer using 14176-1-AP (GK3P antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 14176-1-PBS in a different storage buffer formulation.

GK3P Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14176-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

14176-1-PBS targets GK3P in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5383

  Product name: Recombinant human GK3P protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 208-553 aa of BC066960

  Sequence: FNIHSLEWDKQLCEFFGIPMEILPHVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPLMPETTALGAAMAAGAAEGVDVWSLEPEDLSAVTMKRFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPEGGDPSVFCSLPLGFFIVSSMAMLIGARYISGIP

• Full Name: glycerol kinase 3 pseudogene
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC066960
• Gene Symbol: GK3P
• Gene ID (NCBI): 2713
• RRID: AB_1288669
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.