GLRB Polyclonal antibody

• 

  WB analysis of mouse brain using 15371-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15371-1-AP (GLRB Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spinal cord using 15371-1-AP

  mouse spinal cord tissue were subjected to SDS PAGE followed by western blot with 15371-1-AP (GLRB Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 15371-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 15371-1-AP (GLRB Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 15371-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 15371-1-AP (GLRB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 15371-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 15371-1-AP (GLRB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat cerebellum using 15371-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 15371-1-AP (GLRB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat cerebellum using 15371-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 15371-1-AP (GLRB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 15371-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 15371-1-AP (GLRB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 15371-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 15371-1-AP (GLRB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GLRB Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15371-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

GLRB, Glycine receptor subunit beta, glycine receptor, beta

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue, mouse spinal cord tissue
• Positive IHC detected in: mouse cerebellum tissue, rat cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

15371-1-AP targets GLRB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4429

  Product name: Recombinant human GLRB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 17-267 aa of BC032635

  Sequence: VEEAYSKEKSSKKGKGKKKQYLCPSQQSAEDLARVPANSTSNILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPSDFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIALPQFDIKKEDIEYGNCTKYYKGTGYYTCVEVIFTLRRQVG

• Full Name: glycine receptor, beta
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC032635
• Gene Symbol: GLRB
• Gene ID (NCBI): 2743
• RRID: AB_2878132
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48167
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glycine is an inhibitory neurotransmitter in the central nervous system. The glycine receptor (GlyR) is a member of the nicotinic acetylcholine receptor of ligand-gated ion channels. This receptor has important roles in a variety of physiological processes, especially in mediating inhibitory neurotransmission in the spinal cord and brain stem. GlyR is a pentameric receptor comprised of alpha and beta subunits. Four alpha-subunits (GLRA1, GLRA2, GLRA3, GLRA4) and one beta-subunit (GLRB) of GlyR have been identified. (PMID: 11409700; 15383648)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	PLoS Biol; mGluR5/ERK signaling regulated the phosphorylation and function of glycine receptor α1ins subunit in spinal dorsal horn of mice.; Authors - Zi-Yang Zhang
mouse	WB	Psychopharmacology (Berl); Contribution of skeletal muscular glycine to rapid antidepressant effects of ketamine in an inflammation-induced mouse model of depression.; Authors - Niannian Huang
mouse	WB	J Neurosci; Spinal cord synaptic plasticity by GlyRβ release from receptor fields and syndapin I-dependent uptake; Authors - Jessica Tröger

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

A (Verified Customer) (11-11-2019)

Immunofluorescent analysis of (4% PFA) fixed rat DRG slices using GlyRB rabbit polyclonal antibody at 1:1000 dilution and Alexa 555 at 1:1000 dilution.

• Applications: Immunofluorescence,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Rat DRG

GLRB Antibody Immunofluorescence, validation (1:1000 dilution) in Rat DRG (Cat no:15371-1-AP)