GLRX3 Polyclonal antibody

• 

  WB analysis using 11254-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11254-1-AP (GLRX3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11254-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11254-1-AP (GLRX3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 11254-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11254-1-AP (GLRX3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 11254-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11254-1-AP (GLRX3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 11254-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11254-1-AP (GLRX3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

GLRX3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11254-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Glutaredoxin 3, GLRX4, Glutaredoxin-3, GRX3, GRX4

---

Tested Applications

• Positive WB detected in: A549 cells, Jurkat cells, MCF7 cells, mouse testis tissue, rat testis tissue
• Positive IHC detected in: human stomach cancer tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 5 publications below
• IHC: See 1 publications below

Product Information

11254-1-AP targets GLRX3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1775

  Product name: Recombinant human GLRX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-289 aa of BC014372

  Sequence: AQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLSSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN

• Full Name: glutaredoxin 3
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC014372
• Gene Symbol: GLRX3
• Gene ID (NCBI): 10539
• RRID: AB_2110374
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O76003
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GLRX3(Glutaredoxin-3) is also named as PICOT, TXNL2. Mammalian glutaredoxin 3 is an essential protein involved in the regulation of signal transduction, for instance during immune cell activation and development of cardiac hypertrophy, presumably in response to redox signals(PMID:20226171). Glrx3 could take a pivotal role in colon and lung cancer cells during the tumorigenesis, which is expressed in lung and colon cancers consistently and preferentially(PMID:19797004).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Chest; Proteomic analysis in lung tissue of smokers and COPD patients.; Authors - Lee Eun Joo EJ
human	WB	Hum Mol Genet; Cytosolic HSC20 integrates de novo iron-sulfur cluster biogenesis with the CIAO1-mediated transfer to recipients.; Authors - Ki Soon Kim
human	WB	Exp Cell Res; TRIM16 protects human periodontal ligament stem cells from oxidative stress-induced damage via activation of PICOT.; Authors - Yi Zhao ; KD Validated
mouse	WB	Biosci Biotechnol Biochem; Identification of proteins that bind to the neuroprotective agent neoechinulin A.; Authors - Shinji Kamisuki ; KD Validated
human	WB	Haematologica; Dimeric ferrochelatase bridges ABCB7 and ABCB10 homodimers in an architecturally defined molecular complex required for heme biosynthesis.; Authors - Nunziata Maio
human	WB	J Clin Invest; CIAO1 loss of function causes a neuromuscular disorder with compromise of nucleocytoplasmic Fe-S enzymes; Authors - Nunziata Maio