• Featured Product
  • KD/KO Validated

GLRX3 Polyclonal antibody

GLRX3 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 11254-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Glutaredoxin 3, GLRX4, Glutaredoxin-3, GRX3, GRX4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, Jurkat cells, MCF7 cells, mouse testis tissue, rat testis tissue
Positive IHC detected inhuman stomach cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11254-1-AP targets GLRX3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1775

Product name: Recombinant human GLRX3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-289 aa of BC014372

Sequence: AQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLSSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN

Predict reactive species
Full Name glutaredoxin 3
Calculated Molecular Weight 37 kDa
Observed Molecular Weight 37-40 kDa
GenBank Accession NumberBC014372
Gene Symbol GLRX3
Gene ID (NCBI) 10539
RRIDAB_2110374
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO76003
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GLRX3(Glutaredoxin-3) is also named as PICOT, TXNL2. Mammalian glutaredoxin 3 is an essential protein involved in the regulation of signal transduction, for instance during immune cell activation and development of cardiac hypertrophy, presumably in response to redox signals(PMID:20226171). Glrx3 could take a pivotal role in colon and lung cancer cells during the tumorigenesis, which is expressed in lung and colon cancers consistently and preferentially(PMID:19797004).

Protocols

Product Specific Protocols
IHC protocol for GLRX3 antibody 11254-1-APDownload protocol
WB protocol for GLRX3 antibody 11254-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Chest

Proteomic analysis in lung tissue of smokers and COPD patients.

Authors - Lee Eun Joo EJ
humanWB

Hum Mol Genet

Cytosolic HSC20 integrates de novo iron-sulfur cluster biogenesis with the CIAO1-mediated transfer to recipients.

Authors - Ki Soon Kim
humanWB

Exp Cell Res

TRIM16 protects human periodontal ligament stem cells from oxidative stress-induced damage via activation of PICOT.

Authors - Yi Zhao
  • KD Validated
mouseWB

Biosci Biotechnol Biochem

Identification of proteins that bind to the neuroprotective agent neoechinulin A.

Authors - Shinji Kamisuki
  • KD Validated
humanWB

Haematologica

Dimeric ferrochelatase bridges ABCB7 and ABCB10 homodimers in an architecturally defined molecular complex required for heme biosynthesis.

Authors - Nunziata Maio
humanWB

J Clin Invest

CIAO1 loss of function causes a neuromuscular disorder with compromise of nucleocytoplasmic Fe-S enzymes

Authors - Nunziata Maio
Loading...
||
New chat Able
正在加载,请稍候...