GNAT3 Polyclonal antibody

• 

  IHC staining of mouse small intestine using 25322-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 25322-1-AP (GNAT3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GNAT3 Polyclonal Antibody for IHC, ELISA

Cat No. 25322-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

GDCA, HG1E

---

Tested Applications

• Positive IHC detected in: mouse small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25322-1-AP targets GNAT3 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18121

  Product name: Recombinant human GNAT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 83-137 aa of BC147016

  Sequence: AIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMTPQLAEVIKRLWRDPGIQ

• Full Name: guanine nucleotide binding protein, alpha transducing 3
• Calculated Molecular Weight: 354 aa, 40 kDa
• GenBank Accession Number: BC147016
• Gene Symbol: GNAT3
• Gene ID (NCBI): 346562
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A8MTJ3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GNAT3 (Guanine nucleotide-binding protein G(t) subunit alpha-3), also known as α-gustducin, is a protein that plays a key role in taste signaling. It is part of the G-protein family and is mainly expressed in Type II taste cells in the taste buds of the tongue. GNAT3 is involved in detecting sweet, bitter, and umami tastes by activating a signaling cascade that includes PLCβ2, TRPM5, and other downstream effectors.