Tested Applications
| Positive IHC detected in | mouse small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25322-1-AP targets GNAT3 in IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18121 Product name: Recombinant human GNAT3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 83-137 aa of BC147016 Sequence: AIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMTPQLAEVIKRLWRDPGIQ Predict reactive species |
| Full Name | guanine nucleotide binding protein, alpha transducing 3 |
| Calculated Molecular Weight | 354 aa, 40 kDa |
| GenBank Accession Number | BC147016 |
| Gene Symbol | GNAT3 |
| Gene ID (NCBI) | 346562 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | A8MTJ3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GNAT3 (Guanine nucleotide-binding protein G(t) subunit alpha-3), also known as α-gustducin, is a protein that plays a key role in taste signaling. It is part of the G-protein family and is mainly expressed in Type II taste cells in the taste buds of the tongue. GNAT3 is involved in detecting sweet, bitter, and umami tastes by activating a signaling cascade that includes PLCβ2, TRPM5, and other downstream effectors.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GNAT3 antibody 25322-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

