GNLY Polyclonal antibody

• 

GNLY Polyclonal Antibody for ELISA

Cat No. 11578-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, ELISA

Synonyms

519, D2S69E, GNLY, granulysin, LAG 2, LAG2, Lymphokine LAG 2, NKG5, Protein NKG5, T cell activation protein 519, TLA519

---

Published Applications

• WB: See 3 publications below
• IF: See 1 publications below

Product Information

11578-1-AP targets GNLY in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2163

  Product name: Recombinant human GNLY protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-145 aa of BC023576

  Sequence: MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL

• Full Name: granulysin
• Calculated Molecular Weight: 16 kDa
• GenBank Accession Number: BC023576
• Gene Symbol: GNLY
• Gene ID (NCBI): 10578
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22749
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Phytomedicine; Citrus alkaline extracts prevent endoplasmic reticulum stress in type II alveolar epithelial cells to ameliorate pulmonary fibrosis via the ATF3/PINK1 pathway.; Authors - Zhichao Wang
human	WB	Phytomedicine; Corynoxine exerts the anti-tumor effect on esophageal squamous cell carcinoma principally via the EZH2-DUSP5-ERK1/2-mediated cell growth inhibition; Authors - Gang Huang
Human		Neoplasma; Calreticulin regulates the expression of MMP14 and ADAR1 through EIF2AK2 signaling to promote the proliferation and progression of malignant melanoma cells; Authors - Li Liang
Human	WB,IF	Oncol Rep; ERp29 counteracts the suppression of malignancy mediated by endoplasmic reticulum stress and promotes the metastasis of colorectal cancer.; Authors - Lili Guo