GNMT Polyclonal antibody

• 

  WB analysis of rat liver using 13495-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 13495-1-AP (GNMT Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 13495-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 13495-1-AP (GNMT Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

GNMT Polyclonal Antibody for ELISA

Cat No. 13495-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

glycine N methyltransferase, GNMT

---

Product Information

13495-1-AP targets GNMT in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4321

  Product name: Recombinant human GNMT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-295 aa of BC032627

  Sequence: MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD

• Full Name: glycine N-methyltransferase
• Calculated Molecular Weight: 295 aa, 33 kDa
• GenBank Accession Number: BC032627
• Gene Symbol: GNMT
• Gene ID (NCBI): 27232
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14749
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.