GPATCH4 Polyclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 24399-1-AP (same clone as 24399-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24399-1-AP (GPATCH4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24399-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 24399-1-AP (same clone as 24399-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 24399-1-AP (GPATCH4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24399-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat kidney using 24399-1-AP (same clone as 24399-1-PBS)

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 24399-1-AP (GPATCH4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24399-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 24399-1-AP (same clone as 24399-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24399-1-AP (GPATCH4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24399-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 24399-1-AP (same clone as 24399-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer slide using 24399-1-AP (GPATCH4 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 24399-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 24399-1-AP (same clone as 24399-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver slide using 24399-1-AP (GPATCH4 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 24399-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 24399-1-AP (same clone as 24399-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver slide using 24399-1-AP (GPATCH4 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 24399-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 24399-1-AP (same clone as 24399-1-PBS)

  Immunofluorescent analysis of HEK-293 cells using 24399-1-AP (GPATCH4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24399-1-PBS in a different storage buffer formulation.

GPATCH4 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 24399-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

24399-1-PBS targets GPATCH4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20095

  Product name: Recombinant human GPATCH4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-189 aa of BC040147

  Sequence: MKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHGVGHDPAKEFTNHWWNELFNKTAANLVVETGQDGVQIRSLSKETTRYNHPKPNLLYQKFVKMATLTSGGEKPNKDLESCSDDDNQGSKSPKILTDEMLLQACEGRTAHKAARLGITMKAKLARLEAQEQAFLARLKGQDPGAPQLQSESK

• Full Name: G patch domain containing 4
• Calculated Molecular Weight: 446 aa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC040147
• Gene Symbol: GPATCH4
• Gene ID (NCBI): 54865
• RRID: AB_2879523
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T3I0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GPATCH4 (G patch domain-containing protein 4) is a 446 amino acid protein containing one G-patch domain. Existing as three alternatively spliced isoforms. This antibody is a rabbit polyclonal antibody raised against the 189 residues of N-terminal of human GPATCH4 protein