GPR107 Polyclonal antibody

• 

  WB analysis of HEK-293 using 25076-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25076-1-AP (GPR107 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse cerebellum using 25076-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 25076-1-AP (GPR107 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 25076-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using GPR107 antibody (25076-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

GPR107 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25076-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

G protein coupled receptor 107, GCDRP, KIAA1624, LUSTR1, Protein GPR107

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse cerebellum tissue
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 6 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

25076-1-AP targets GPR107 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18649

  Product name: Recombinant human GPR107 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 41-260 aa of BC110518

  Sequence: VHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKNPDSYLSAGEI

• Full Name: G protein-coupled receptor 107
• Calculated Molecular Weight: 552 aa, 67 kDa
• Observed Molecular Weight: 60-67 kDa
• GenBank Accession Number: BC110518
• Gene Symbol: GPR107
• Gene ID (NCBI): 57720
• RRID: AB_2879886
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VW38
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR107 also named as KIAA1624 or LUSTR1 is 600 amino acid protein, which belongs to the LU7TM family. GPR107 localizes in membrane and is a multi-pass membrane protein. GPR107 is a promising candidate receptor for neuronostatin, and neuronostatin, interacting with GPR107, may play an important role in the central control of cardiovascular function.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Chem Biol; A proteome-wide map of 20(S)-hydroxycholesterol interactors in cell membranes.; Authors - Yu-Shiuan Cheng
human	WB,IHC,IF	J Exp Clin Cancer Res; LncGPR107 drives the self-renewal of liver tumor initiating cells and liver tumorigenesis through GPR107-dependent manner.; Authors - Guanqun Huang
mouse	WB	Neurochem Res; Neuronostatin Promotion Soluble Aβ1-42 Oligomers: Induced Dysfunctional Brain Glucose Metabolism in Mice.; Authors - Shaobin Yang
mouse	WB	Behav Brain Res; Neuronostatin promotes soluble Aβ1-42 oligomers -induced spatial learning and memory impairments in mice.; Authors - Shaobin Yang ; KD Validated
human	WB	Nat Chem Biol; Chemoproteomics reveals microbiota-derived aromatic monoamine agonists for GPRC5A; Authors - Xiaohui Zhao
mouse	WB,IF	Neuropharmacology; Neuronostatin regulates neuronal function and energetic metabolism in Alzheimer's disease in a GPR107-dependent manner; Authors - Shaobin Yang ; KO Validated