Product Information
85207-1-PBS targets GPR132 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1598 Product name: Recombinant Human GPR132 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-45 aa of BC084546 Sequence: MCPMLLKNGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRIVL Predict reactive species |
| Full Name | G protein-coupled receptor 132 |
| Calculated Molecular Weight | 380 aa, 43 kDa |
| GenBank Accession Number | BC084546 |
| Gene Symbol | GPR132 |
| Gene ID (NCBI) | 29933 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UNW8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
