Product Information
28449-1-AP targets GPR146 in ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29194 Product name: Recombinant human GPR146 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC014241 Sequence: MWSCSWFNGTGLVEELPACQDLQLGLSLLSLLGLVVGVPVGLCYNALLVLANLHSKASMTMPDVYFVNMAVAGLVLSALAPVHLLGPPSSRWALWSVGGEVHVALQIPFN Predict reactive species |
Full Name | G protein-coupled receptor 146 |
Calculated Molecular Weight | 333 aa, 37 kDa |
GenBank Accession Number | BC014241 |
Gene Symbol | GPR146 |
Gene ID (NCBI) | 115330 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96CH1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |