Tested Applications
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25996-1-AP targets GPR148 in IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22948 Product name: Recombinant human GPR148 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC105013 Sequence: MGDELAPCPVGTTAWPALIQLISKTPCMPQAASNTSLGLGDLRVPSSMLYWLFLPSSLLAAATLAVSPLLLVTILRNQRLRQEPHYLLPANILLS Predict reactive species |
| Full Name | G protein-coupled receptor 148 |
| Calculated Molecular Weight | 347 aa, 38 kDa |
| GenBank Accession Number | BC105013 |
| Gene Symbol | GPR148 |
| Gene ID (NCBI) | 344561 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TDV2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPR148, also known as BTR or PGR6, belongs to a G protein-coupled receptor (GPCR) family. It is primarily expressed in the brain and testis, suggesting a role in specific sensory functions and possibly in reproductive processes. As a GPCR, GPR148 is likely to be involved in signal transduction pathways triggered by the binding of specific ligands, such as odorants or other small molecules.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GPR148 antibody 25996-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





