Tested Applications
Positive WB detected in | HeLa cells, K-562 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
30104-1-AP targets GPR151 in WB, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag32442 Product name: Recombinant human GPR151 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 308-419 aa of NM_194251 Sequence: VMSEEFREGLKGVWKWMITKKPPTVSESQETPAGNSEGLPDKVPSPESPASIPEKEKPSSPSSGKGKTEKAEIPILPDVEQFWHERDTVPSVQDNDPIPWEHEDQETGEGVK Predict reactive species |
Full Name | G protein-coupled receptor 151 |
Calculated Molecular Weight | 47kd |
Observed Molecular Weight | 46 kDa |
GenBank Accession Number | NM_194251 |
Gene Symbol | GPR151 |
Gene ID (NCBI) | 134391 |
RRID | AB_3086229 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8TDV0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
G protein-coupled receptors (GPCRs) are a superfamily of cell-surface receptors which are important for intracellular signal transduction. GPR151 (G protein-coupled receptor 151) is highly enriched in the the medial and lateral habenula and is expressed at presynaptic membranes and synaptic vesicles (PMID: 32098843). GPR151 has been reported to play an important role in modulating neuropathic pain and controling nicotine addiction vulnerability (PMID: 32098843,34244727,30373770).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GPR151 antibody 30104-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |