Product Information
83557-5-PBS targets GPR161 as part of a matched antibody pair:
MP00542-1: 83557-5-PBS capture and 83557-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag30998 Product name: Recombinant human GPR161 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 362-460 aa of BC028163 Sequence: SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD Predict reactive species |
| Full Name | G protein-coupled receptor 161 |
| Calculated Molecular Weight | 529 aa, 59 kDa |
| GenBank Accession Number | BC028163 |
| Gene Symbol | GPR161 |
| Gene ID (NCBI) | 23432 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8N6U8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

