GPR172B Polyclonal antibody

• 

  WB analysis using 20791-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20791-1-AP (GPR172B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 20791-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20791-1-AP (GPR172B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 20791-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20791-1-AP (GPR172B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GPR172B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20791-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

GPCR42, hRFT1, PAR2, PERV A receptor 2, Protein GPR172B

---

Tested Applications

• Positive WB detected in: human placenta tissue, mouse testis tissue, rat testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20791-1-AP targets GPR172B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14525

  Product name: Recombinant human GPR172B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 201-290 aa of BC060810

  Sequence: TALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEVHQLFSAHGAFLLGLMAFTS

• Full Name: G protein-coupled receptor 172B
• Calculated Molecular Weight: 448 aa, 46 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC060810
• Gene Symbol: GPR172B
• Gene ID (NCBI): 55065
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWF4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR172B, also known as solute carrier family 52 member 1 (SLC52A1) or riboflavin transporter 1 (RFT1), is a G protein-coupled receptor (GPCR) that plays a significant role in the transport of riboflavin, a vital component for the production of flavin adenine dinucleotide (FAD) and flavin mononucleotide (FMN). GPR172B plays a role in cellular aging. Knockdown of GPR172B promotes senescence induced by DNA damage in both tumor and normal cells. The anti-senescence effect of GPR172B is dependent on its riboflavin transport activity, which leads to the activation of mitochondrial membrane potential (MMP) mediated by mitochondrial electron transport chain complex II, ultimately inhibiting the AMPK-p53 pathway, a central mediator of senescence-associated with mitochondrial dysfunction.