GPR58/TAAR2 Polyclonal antibody, PBS Only

• 

  WB analysis of rat brain using 24609-1-AP (same clone as 24609-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 24609-1-AP (GPR58/TAAR2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24609-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse cerebellum using 24609-1-AP (same clone as 24609-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 24609-1-AP (GPR58/TAAR2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24609-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 24609-1-AP (same clone as 24609-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24609-1-AP (GPR58/TAAR2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24609-1-PBS in a different storage buffer formulation.

GPR58/TAAR2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24609-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24609-1-PBS targets GPR58/TAAR2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18939

  Product name: Recombinant human TAAR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 111-203 aa of BC067461

  Sequence: TIPVIKRLLLLCWSVPGAFAFGVVFSEAYADGIEGYDILVACSSSCPVMFNKLWGTTLFMAGFFTPGSMMVGIYGKIFAVSRKHAHAINNLRE

• Full Name: trace amine associated receptor 2
• Calculated Molecular Weight: 351 aa, 40 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC067461
• Gene Symbol: TAAR2
• Gene ID (NCBI): 9287
• RRID: AB_2879636
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P1P5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.