GPR97 Polyclonal antibody

• 

  IHC staining of mouse ovary using 16756-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 16756-1-AP (GPR97 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse ovary using 16756-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 16756-1-AP (GPR97 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GPR97 Polyclonal Antibody for IHC, ELISA

Cat No. 16756-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

ADGRG3, Adhesion G protein-coupled receptor G3, G protein coupled receptor 97, GPR 97, G-protein coupled receptor 97

---

Tested Applications

• Positive IHC detected in: mouse ovary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16756-1-AP targets GPR97 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10272

  Product name: Recombinant human GPR97 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-274 aa of BC064508

  Sequence: KPTEGPRNTCLGSNNMYDIFNLNDKALCFTKCRQSGSDSCNVENLQRYWLNYEAHLMKEGLTQKVNTPFLKALVQNLSTNTAEDFYFSLEPSQVPRQVMKDEDKPPDRVRLPKSLFRSLPGNRSVVRLAVTILDIGPGTLFKGPRLGLGDGSGVLNNRLVGLSVGQMHVTKLAEPLEIVFSHQRPPPNMTLTCVFWDVTKGTTGDWSSEGCSTEVRPEGTVCCCDHLTFFALLLRPTLDQSTVHILTRISQA

• Full Name: G protein-coupled receptor 97
• Calculated Molecular Weight: 549 aa, 61 kDa
• GenBank Accession Number: BC064508
• Gene Symbol: GPR97
• Gene ID (NCBI): 222487
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86Y34
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR97, also known as adhesion G-protein-coupled receptor G3 (ADGRG3), belongs to the GPCR family. GPR97 is involved in acute kidney injury (AKI) progression, with GPR97 deficiency reducing renal injury and inflammation in AKI models (PMID: 30559745).