GRK4 Polyclonal antibody

• 

  WB analysis using 33470-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33470-1-AP (GRK4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

GRK4 Polyclonal Antibody for WB, ELISA

Cat No. 33470-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

EC:2.7.11.16, G protein-coupled receptor kinase 4, G protein-coupled receptor kinase GRK4, GPRK2L, GPRK4

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33470-1-AP targets GRK4 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38007

  Product name: Recombinant human GRK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 381-510 aa of NM_182982.2

  Sequence: QGHSPFKKYKEKVKWEEVDQRIKNDTEEYSEKFSEDAKSICRMLLTKNPSKRLGCRGEGAAGVKQHPVFKDINFRRLEANMLEPPFCPDPHAVYCKDVLDIEQFSVVKGIYLDTADEDFYARFATGCVSI

• Full Name: G protein-coupled receptor kinase 4
• Calculated Molecular Weight: NM_182982.2
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: NM_182982.2
• Gene Symbol: GRK4
• Gene ID (NCBI): 2868
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P32298
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

G protein-coupled receptor kinase 4 (GRK4) is a serine and threonine kinase that phosphorylates G protein-coupled receptors in response to agonist stimulation. It uncouples the dopamine receptor from its G protein. It should also be noted that kinase activity is not necessary for some GRK-mediated functions.