GRSF1 Polyclonal antibody

GRSF1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 30992-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

FLJ13125, G rich sequence factor 1, GRSF 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, L02 cells, PANC-1 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU-251 cells, A431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30992-1-AP targets GRSF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag34305

Product name: Recombinant human GRSF1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 282-404 aa of NM_002092

Sequence: MDYRGRRKTGEAYVQFEEPEMANQALLKHREEIGNRYIEIFPSRRNEVRTHVGSYKGKKIASFPTAKYITEPEMVFEEHEVNEDIQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVH

Predict reactive species
Full Name G-rich RNA sequence binding factor 1
Calculated Molecular Weight53 kDa
Observed Molecular Weight50-53 kDa
GenBank Accession NumberNM_002092
Gene Symbol GRSF1
Gene ID (NCBI) 2926
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ12849
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Grsf1 (G-rich RNA sequence binding factor 1) is an RNA-binding protein, which belongs to the F/H family of heterogeneous ribonucleoprotein, and contains three quasi-RNA recognition motifs (qRRM). These domains enable it to bind to RNA molecules, and it interacts with various RNA molecules, including mRNA, lncRNA and circRNA, affecting the metabolism and function of these RNAs. The expression of GRSF1 is closely related to cell senescence. It was found that with the aging of cells, the methylation level in the promoter region of GRSF1 gene increased, which led to the decrease of its expression. The decrease of GRSF1 expression is related to the activation of various aging-related markers and the increase of the secretion of aging-related secretory phenotype (SASP) factors, which may play a key role in maintaining the normal function of cells and delaying the aging process. GRSF1 also plays an important role in the mitochondria of cells. It interacts with RNase P and participates in the processing of mitochondrial RNA, including the processing of classical and tRNA-free RNA precursors. In the case of GRSF1 deletion, the primary transcript of mitochondrial RNA is cut abnormally, which leads to the decrease of the expression of mitochondrial coding protein, and then causes mitochondrial dysfunction. Isoform 1, 53 kDa, located in mitochondria; Isoform 2, 36 kDa, located in cytoplasm.

Protocols

Product Specific Protocols
IF protocol for GRSF1 antibody 30992-1-APDownload protocol
IHC protocol for GRSF1 antibody 30992-1-APDownload protocol
WB protocol for GRSF1 antibody 30992-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...