GRSF1 Polyclonal antibody

• 

  WB analysis using 30992-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30992-1-AP (GRSF1 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 30992-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 30992-1-AP (GRSF1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 30992-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using GRSF1 antibody (30992-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• 

  IF Staining of U-251 using 30992-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using GRSF1 antibody (30992-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

GRSF1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30992-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FLJ13125, G rich sequence factor 1, GRSF 1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, L02 cells, PANC-1 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U-251 cells, A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30992-1-AP targets GRSF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34305

  Product name: Recombinant human GRSF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 282-404 aa of NM_002092

  Sequence: MDYRGRRKTGEAYVQFEEPEMANQALLKHREEIGNRYIEIFPSRRNEVRTHVGSYKGKKIASFPTAKYITEPEMVFEEHEVNEDIQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVH

• Full Name: G-rich RNA sequence binding factor 1
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 50-53 kDa
• GenBank Accession Number: NM_002092
• Gene Symbol: GRSF1
• Gene ID (NCBI): 2926
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q12849
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Grsf1 (G-rich RNA sequence binding factor 1) is an RNA-binding protein, which belongs to the F/H family of heterogeneous ribonucleoprotein, and contains three quasi-RNA recognition motifs (qRRM). These domains enable it to bind to RNA molecules, and it interacts with various RNA molecules, including mRNA, lncRNA and circRNA, affecting the metabolism and function of these RNAs. The expression of GRSF1 is closely related to cell senescence. It was found that with the aging of cells, the methylation level in the promoter region of GRSF1 gene increased, which led to the decrease of its expression. The decrease of GRSF1 expression is related to the activation of various aging-related markers and the increase of the secretion of aging-related secretory phenotype (SASP) factors, which may play a key role in maintaining the normal function of cells and delaying the aging process. GRSF1 also plays an important role in the mitochondria of cells. It interacts with RNase P and participates in the processing of mitochondrial RNA, including the processing of classical and tRNA-free RNA precursors. In the case of GRSF1 deletion, the primary transcript of mitochondrial RNA is cut abnormally, which leads to the decrease of the expression of mitochondrial coding protein, and then causes mitochondrial dysfunction. Isoform 1, 53 kDa, located in mitochondria; Isoform 2, 36 kDa, located in cytoplasm.