GS15 Monoclonal antibody, PBS Only (Detector)

GS15 Monoclonal Antibody for Indirect ELISA, Cytometric bead array
Cat No. 68856-2-PBS
Clone No.2A2B4

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

Cytometric bead array, Indirect ELISA

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68856-2-PBS targets GS15 as part of a matched antibody pair:

MP50251-1: 68856-1-PBS capture and 68856-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity Human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5506

Product name: Recombinant human GS15 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-102 aa of BC032779

Sequence: MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMVRAHGVRVSVPCPSTTCCRACSVSFSTGAGGWSNHHFCVILLGFLP

Predict reactive species
Full Name blocked early in transport 1 homolog (S. cerevisiae)-like
Calculated Molecular Weight 102 aa, 11 kDa
GenBank Accession NumberBC032779
Gene Symbol BET1L
Gene ID (NCBI) 51272
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A Magarose purification
UNIPROT IDQ9NYM9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...