GSTA3 Polyclonal antibody

• 

  WB analysis using 16703-1-AP

  mouse testis tissue was subjected to SDS PAGE followed by western blot with 16703-1-AP (GSTA3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat testis using 16703-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 16703-1-AP (GSTA3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 16703-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 16703-1-AP (GSTA3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 16703-1-AP

  IP result of anti-GSTA3 (IP:16703-1-AP, 4ug; Detection:16703-1-AP 1:500) with mouse testis tissue lysate 4800ug.

• 

  IF Staining of MCF-7 using 16703-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using GSTA3 antibody (16703-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

GSTA3 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 16703-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

GST class-alpha member 3, Glutathione S-transferase A3-3, Glutathione S-transferase A3, Glutathione S transferase A3 3, Glutathione S transferase A3

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue, human testis tissue
• Positive IP detected in: mouse testis tissue
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below

Product Information

16703-1-AP targets GSTA3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10101

  Product name: Recombinant human GSTA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-222 aa of BC020619

  Sequence: MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF

• Full Name: glutathione S-transferase alpha 3
• Calculated Molecular Weight: 222 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC020619
• Gene Symbol: GSTA3
• Gene ID (NCBI): 2940
• RRID: AB_2279523
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16772
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Front Pharmacol; PDE9 Inhibitor PF-04447943 Attenuates DSS-Induced Colitis by Suppressing Oxidative Stress, Inflammation, and Regulating T-Cell Polarization.; Authors - Mohammad Nasiruddin Rana
mouse	WB	Age (Dordr); PMID: 25001375; Authors - Lalida Rojanathammanee
mouse	WB	Am J Pathol; Novel Protective Role of Nicotinamide Phosphoribosyltransferase in Acetaminophen-Induced Acute Liver Injury in Mice.; Authors - Li Qin Zhang
rat	WB	PLoS One; Heat-Not-Burn cigarette induces oxidative stress response in primary rat alveolar epithelial cells.; Authors - Yoko Ito
mouse	WB	J Toxicol Pathol; Thioacetamide-induced Hepatocellular Necrosis Is Attenuated in Diet-induced Obese Mice.; Authors - Shirai Makoto M
human	IHC	Radiother Oncol; Transcriptomic and epigenetic landscape of nimorazole-enhanced radiochemotherapy in head and neck cancer; Authors - María José Besso