GSTO1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• GSTO1 Monoclonal antibody (60150-2-Ig)

GSTO1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60150-2-Ig

Clone No.5E1E10

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:1.20.4.2, EC:1.8.5.1, EC:2.5.1.18, glutathione S transferase omega 1, Glutathione S-transferase omega 1-1

• 

  WB analysis using 60150-2-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 60150-2-Ig

  human heart tissue were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U-937 using 60150-2-Ig

  U-937 cells were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 60150-2-Ig

  Raji cells were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of ROS1728 using 60150-2-Ig

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 60150-2-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 60150-2-Ig

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 60150-2-Ig

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 60150-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 60150-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 60150-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 60150-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of PC-3 using 60150-2-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using GSTO1 antibody (60150-2-Ig, Clone: 5E1E10 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A549 cells, human heart tissue, U-937 cells, Raji cells, ROS1728 cells, NIH/3T3 cells, A431 cells, HeLa cells, Jurkat cells, K-562 cells
• Positive IHC detected in: human oesophagus cancer tissue, human liver tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60150-2-Ig targets GSTO1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7199

  Product name: Recombinant human GSTO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-241 aa of BC000127

  Sequence: MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL

• Full Name: glutathione S-transferase omega 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC000127
• Gene Symbol: GSTO1
• Gene ID (NCBI): 9446
• RRID: AB_10644447
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P78417
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glutathione-S-transferase omega 1 (GSTO1) belongs to a new subfamily of GSTs and is the rate limiting enzyme for biotransformation of inorganic arsenic, environmental carcinogen. Expression of GSTO1-1 was abundant in a wide range of normal tissues, particularly liver, macrophages, glial cells, and endocrine cells.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Toxicol Appl Pharmacol; Effects of Nrf2 deficiency on arsenic metabolism in mice.; Authors - Huihui Wang