GSTO1 Monoclonal antibody

GSTO1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60150-2-Ig

Clone No. 5E1E10

Publications (1)

Review Product

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:1.20.4.2, EC:1.8.5.1, EC:2.5.1.18, glutathione S transferase omega 1, Glutathione S-transferase omega 1-1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite®594

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis using 60150-2-Ig
Various lysates were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human heart using 60150-2-Ig
human heart tissue were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of U-937 using 60150-2-Ig
U-937 cells were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Raji using 60150-2-Ig
Raji cells were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of ROS1728 using 60150-2-Ig
ROS1728 cells were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of NIH/3T3 using 60150-2-Ig
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human oesophagus cancer using 60150-2-Ig
Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human oesophagus cancer using 60150-2-Ig
Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 60150-2-Ig
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 60150-2-Ig
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 60150-2-Ig
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:50.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 60150-2-Ig
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:50.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of PC-3 using 60150-2-Ig
Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using GSTO1 antibody (60150-2-Ig, Clone: 5E1E10 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GSTO1 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A549 cells, human heart tissue, U-937 cells, Raji cells, ROS1728 cells, NIH/3T3 cells, A431 cells, HeLa cells, Jurkat cells, K-562 cells
Positive IHC detected in	human oesophagus cancer tissue, human liver tissue, human liver cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	PC-3 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60150-2-Ig targets GSTO1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	mouse
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag7199 Product name: Recombinant human GSTO1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-241 aa of BC000127 Sequence: MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL Predict reactive species
Full Name	glutathione S-transferase omega 1
Calculated Molecular Weight	28 kDa
Observed Molecular Weight	27-30 kDa
GenBank Accession Number	BC000127
Gene Symbol	GSTO1
Gene ID (NCBI)	9446
RRID	AB_10644447
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P78417
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glutathione-S-transferase omega 1 (GSTO1) belongs to a new subfamily of GSTs and is the rate limiting enzyme for biotransformation of inorganic arsenic, environmental carcinogen. Expression of GSTO1-1 was abundant in a wide range of normal tissues, particularly liver, macrophages, glial cells, and endocrine cells.

Protocols

Product Specific Protocols
IF protocol for GSTO1 antibody 60150-2-Ig	Download protocol
IHC protocol for GSTO1 antibody 60150-2-Ig	Download protocol
WB protocol for GSTO1 antibody 60150-2-Ig	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The GSTO1 Monoclonal antibody (5E1E10), catalog number 60150-2-Ig, has a total of 1 citation. The cited publication appeared in Toxicology and Applied Pharmacology (2017), studying the effects of Nrf2 deficiency on arsenic metabolism in mice using Western blot. The research field encompasses toxicology, heavy metal (arsenic) metabolism, and oxidative stress signaling pathways.