GSTO1 Monoclonal antibody, PBS Only

• 

  WB analysis using 60150-2-Ig (same clone as 60150-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60150-2-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 60150-2-Ig (same clone as 60150-2-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60150-2-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 60150-2-Ig (same clone as 60150-2-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60150-2-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 60150-2-Ig (same clone as 60150-2-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60150-2-PBS in a different storage buffer formulation.

• 

  WB analysis of ROS1728 using 60150-2-Ig (same clone as 60150-2-PBS)

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60150-2-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 60150-2-Ig (same clone as 60150-2-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 60150-2-Ig (GSTO1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60150-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 60150-2-Ig (same clone as 60150-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60150-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 60150-2-Ig (same clone as 60150-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60150-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 60150-2-Ig (same clone as 60150-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60150-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 60150-2-Ig (same clone as 60150-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60150-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 60150-2-Ig (same clone as 60150-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 60150-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 60150-2-Ig (same clone as 60150-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 60150-2-Ig (GSTO1 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 60150-2-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 60150-2-Ig (same clone as 60150-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using GSTO1 antibody (60150-2-Ig, Clone: 5E1E10 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 60150-2-PBS in a different storage buffer formulation.

GSTO1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 60150-2-PBS

Clone No.5E1E10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

EC:1.20.4.2, EC:1.8.5.1, EC:2.5.1.18, glutathione S transferase omega 1, Glutathione S-transferase omega 1-1

---

Product Information

60150-2-PBS targets GSTO1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7199

  Product name: Recombinant human GSTO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-241 aa of BC000127

  Sequence: MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL

• Full Name: glutathione S-transferase omega 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC000127
• Gene Symbol: GSTO1
• Gene ID (NCBI): 9446
• RRID: AB_10644447
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P78417
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glutathione-S-transferase omega 1 (GSTO1) belongs to a new subfamily of GSTs and is the rate limiting enzyme for biotransformation of inorganic arsenic, environmental carcinogen. Expression of GSTO1-1 was abundant in a wide range of normal tissues, particularly liver, macrophages, glial cells, and endocrine cells.