CoraLite®594-conjugated GSTO1 Monoclonal antibody

• 

  IF Staining of PC-3 using CL594-60150

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using CoraLite®594 GSTO1 antibody (CL594-60150, Clone: 5E1E10 ) at dilution of 1:200.

GSTO1 Monoclonal Antibody for IF/ICC

Cat No. CL594-60150

Clone No.5E1E10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

DKFZp686H13163, GSTO 1, GSTO1, GSTTLp28, P28

---

Tested Applications

• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-60150 targets GSTO1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7199

  Product name: Recombinant human GSTO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-241 aa of BC000127

  Sequence: MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL

• Full Name: glutathione S-transferase omega 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC000127
• Gene Symbol: GSTO1
• Gene ID (NCBI): 9446
• RRID: AB_2883428
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P78417
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Glutathione-S-transferase omega 1 (GSTO1) belongs to a new subfamily of GSTs and is the rate limiting enzyme for biotransformation of inorganic arsenic, environmental carcinogen. Expression of GSTO1-1 was abundant in a wide range of normal tissues, particularly liver, macrophages, glial cells, and endocrine cells.