GTF2H3 Polyclonal antibody, PBS Only

• 

  WB analysis using 14857-1-AP (same clone as 14857-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14857-1-AP (GTF2H3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14857-1-PBS in a different storage buffer formulation.

GTF2H3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14857-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

14857-1-PBS targets GTF2H3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6652

  Product name: Recombinant human GTF2H3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-210 aa of BC065250

  Sequence: KQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDIT

• Full Name: general transcription factor IIH, polypeptide 3, 34kDa
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 30-34 kDa
• GenBank Accession Number: BC065250
• Gene Symbol: GTF2H3
• Gene ID (NCBI): 2967
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13889
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.