Granzyme A Polyclonal antibody

• 

  WB analysis using 11288-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11288-1-AP (Granzyme A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 11288-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 11288-1-AP (Granzyme A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lymphoma using 11288-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 11288-1-AP (Granzyme A antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human lymphoma using 11288-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 11288-1-AP (Granzyme A antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lymphoma using 11288-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11288-1-AP (Granzyme A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Granzyme A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11288-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

GrA, GZMA, CTL tryptase, CTLA3, Cytotoxic T-lymphocyte proteinase 1

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, rat kidney tissue
• Positive IHC detected in: human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 4 publications below
• IF: See 3 publications below

Product Information

11288-1-AP targets Granzyme A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1818

  Product name: Recombinant human GZMA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-262 aa of BC015739

  Sequence: MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV

• Full Name: granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 27-30 kDa, 50-60 kDa
• GenBank Accession Number: BC015739
• Gene Symbol: Granzyme A
• Gene ID (NCBI): 3001
• RRID: AB_2114392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12544
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Granzyme A(GrA, a tryptase) is necessary for target cell lysis in cell-mediated immune responses. It activates mitochondrial outer membrane permeabilization- and caspase-independent cell death pathways by cleaving the mitochondrial complex I component NDUFS3after lys56. Among serine proteases GrA has an unique quaternary structure consisting of a disulphide-linked homodimer of 60kDa linked via Cys93.(PMID: 12819769) This protein has 2 isoforms produced by alternative promoter usage with the MW of 29 and 27 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Int J Biol Sci; Rapamycin and Low-dose IL-2 Mediate an Immunosuppressive Microenvironment to Inhibit Benign Prostatic Hyperplasia; Authors - Tianyu Cao
human	WB	J Proteomics; Proteomic profiling of human decidual immune proteins during Toxoplasma gondii infection.; Authors - Dan Zhang
human	IHC	Immunopharmacol Immunotoxicol; Identification of discrepancy between CTLA4 expression and CTLA4 activation in gastric cancer.; Authors - Zhen Xiang
chicken	WB	Res Vet Sci; Characterization of cytotoxicity-related gene expression in response to virulent Marek's disease virus infection in the bursa of Fabricius.; Authors - Cui-Ying Chen
chicken	WB,IF	Dev Comp Immunol; Perforin and granzyme A release as novel tool to measure NK cell activation in chickens; Authors - Adil Ijaz
mouse	IHC	Front Immunol; PD-L1 targeted peptide demonstrates potent antitumor and immunomodulatory activity in cancer immunotherapy; Authors - Yulai Liang