Granzyme K Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Granzyme K Polyclonal antibody (27894-1-AP)

Granzyme K Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 27894-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

GZMK, Granzyme-3, Granzyme3, Granzyme 3, Fragmentin-3

• 

  IHC staining of human tonsillitis using 27894-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 27894-1-AP (GZMK antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 27894-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 27894-1-AP (GZMK antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 27894-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 27894-1-AP (GZMK antibody) at dilution of 1:500 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of NK-92 using 27894-1-AP

  Immunofluorescent analysis of (4% PFA) fixed NK-92 cells using Granzyme K antibody (27894-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NK-92 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27894-1-AP targets Granzyme K in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27281

  Product name: Recombinant human GZMK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 85-215 aa of BC035802

  Sequence: HSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSG

• Full Name: granzyme K (granzyme 3; NK tryptase II)
• Calculated Molecular Weight: 29 kDa
• GenBank Accession Number: BC035802
• Gene Symbol: GZMK
• Gene ID (NCBI): 3003
• RRID: AB_2881008
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49863
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Granzymes are a family of serine proteases stored in granules inside cytotoxic cells of the immune system. There are five human granzymes (granzyme A (GrA), GrB, GrH, GrK and GrM) currently identified, whereas mice have ten known granzymes (GrA-G, GrK, GrM and GrN) (PMID:14499263). Human GrK was first discovered in 1988 after purification from human peripheral blood mononuclear cells. GrK is expressed by cytotoxic T lymphocytes, natural killer T cells (NKT), γδ T cells and CD56bright+ NK cells.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	iScience; CircSOBP suppresses the progression of glioma by disrupting glycolysis and promoting the MDA5-mediated immune response; Authors - Maolin Mu