Granzyme K Polyclonal antibody

Granzyme K Polyclonal Antibody for IHC, IF/ICC, ELISA
Cat No. 27894-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

GZMK, Granzyme-3, Granzyme3, Granzyme 3, Fragmentin-3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNK-92 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

27894-1-AP targets Granzyme K in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27281

Product name: Recombinant human GZMK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 85-215 aa of BC035802

Sequence: HSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSG

Predict reactive species
Full Name granzyme K (granzyme 3; NK tryptase II)
Calculated Molecular Weight 29 kDa
GenBank Accession NumberBC035802
Gene Symbol GZMK
Gene ID (NCBI) 3003
RRIDAB_2881008
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP49863
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Granzymes are a family of serine proteases stored in granules inside cytotoxic cells of the immune system. There are five human granzymes (granzyme A (GrA), GrB, GrH, GrK and GrM) currently identified, whereas mice have ten known granzymes (GrA-G, GrK, GrM and GrN) (PMID:14499263). Human GrK was first discovered in 1988 after purification from human peripheral blood mononuclear cells. GrK is expressed by cytotoxic T lymphocytes, natural killer T cells (NKT), γδ T cells and CD56bright+ NK cells.

Protocols

Product Specific Protocols
IF protocol for Granzyme K antibody 27894-1-APDownload protocol
IHC protocol for Granzyme K antibody 27894-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

iScience

CircSOBP suppresses the progression of glioma by disrupting glycolysis and promoting the MDA5-mediated immune response

Authors - Maolin Mu
Loading...
||
New chat Able
正在加载,请稍候...