Galectin 10 Monoclonal antibody

• 

  WB analysis of HL-60 using 67581-1-Ig

  HL-60 cells were subjected to SDS PAGE followed by western blot with 67581-1-Ig (CLC antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human peripheral blood leukocyte using 67581-1-Ig

  Human peripheral blood leukocyte were subjected to SDS PAGE followed by western blot with 67581-1-Ig (CLC antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

Galectin 10 Monoclonal Antibody for WB, ELISA

Cat No. 67581-1-Ig

Clone No.5D9B7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, ELISA

Synonyms

CLC, 5D9B7, Charcot Leyden crystal protein, Charcot-Leyden crystal protein, Gal 10

---

Tested Applications

• Positive WB detected in: HL-60 cells, Human peripheral blood leukocyte

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67581-1-Ig targets Galectin 10 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18569

  Product name: Recombinant human CLC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-142 aa of BC119711

  Sequence: MSLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

• Full Name: Charcot-Leyden crystal protein
• Calculated Molecular Weight: 142 aa, 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC119711
• Gene Symbol: Galectin 10
• Gene ID (NCBI): 1178
• RRID: AB_2882792
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q05315
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Galectin-10 (Gal-10), also called Charcot-Leyden Crystal (CLC) protein, is a member of the galectin superfamily of galactoside-binding lectins and is most prominently expressed in human eosinophils, where it forms the classic hexagonal bipyramidal Charcot-Leyden crystals that are considered hallmarks of eosinophilic inflammatory reactions