Gastrin Monoclonal antibody

• 

  IHC staining of human stomach using 60346-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 60346-1-Ig (Gastrin antibody) at dilution of 1:350 (under 10x lens).

• 

  IHC staining of human stomach using 60346-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 60346-1-Ig (Gastrin antibody) at dilution of 1:350 (under 40x lens).

• 

  IF Staining of human stomach cancer using 60346-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human stomach cancer tissue using Gastrin antibody (60346-1-Ig, Clone: 7G9C3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Gastrin Monoclonal Antibody for IHC, IF-P, ELISA

Cat No. 60346-1-Ig

Clone No.7G9C3

Publications(2)

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IHC, IF-P, ELISA

Synonyms

G14 Gastrin 6, G17 Gastrin 14, G34 Gastrin, G52 Big gastrin, G6, GAS, GAST, gastrin, Gastrin 17, Gastrin 34, Gastrin component I Gastrin 52, Gastrin component II, Gastrin component III

---

Tested Applications

• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human stomach cancer tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:100-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

60346-1-Ig targets Gastrin in IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12795

  Product name: Recombinant human GAST protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-101 aa of BC069724

  Sequence: SEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN

• Full Name: gastrin
• Calculated Molecular Weight: 101 aa, 11 kDa
• GenBank Accession Number: BC069724
• Gene Symbol: Gastrin
• Gene ID (NCBI): 2520
• RRID: AB_2881455
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01350
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Gastrin is a hormone produced primarily by G-cells in the stomach, where it functions to stimulate acid secretion by gastric parietal cells. Gastrin is a promiscuous hormone. Thus, the gastrin gene is expressed in common cancers such as bronchogenic, colorectal, ovarian and pancreatic carcinomas.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell; High-Resolution mRNA and Secretome Atlas of Human Enteroendocrine Cells.; Authors - Joep Beumer
human	IHC	Virchows Arch; Mixed adenoma-neuroendocrine tumor of the stomach: analysis of nine cases with literature review; Authors - Hirofumi Rokutan