CoraLite®594-conjugated Gastrin Monoclonal antibody

• 

  IF Staining of human stomach cancer using CL594-60346

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human stomach cancer tissue using CoraLite®594 Gastrin antibody (CL594-60346, Clone: 7G9C3 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human stomach cancer using CL594-60346

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human stomach cancer tissue using CoraLite®594 Gastrin antibody (CL594-60346, Clone: 7G9C3 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Gastrin Monoclonal Antibody for IF-P

Cat No. CL594-60346

Clone No.7G9C3

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF-P

Synonyms

G14 Gastrin 6, G17 Gastrin 14, G34 Gastrin, G52 Big gastrin, G6, GAS, GAST, gastrin, Gastrin 17, Gastrin 34, Gastrin component I Gastrin 52, Gastrin component II, Gastrin component III

---

Tested Applications

• Positive IF-P detected in: human stomach cancer tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-60346 targets Gastrin in IF-P applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12795

  Product name: Recombinant human GAST protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-101 aa of BC069724

  Sequence: SEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN

• Full Name: gastrin
• Calculated Molecular Weight: 101 aa, 11 kDa
• GenBank Accession Number: BC069724
• Gene Symbol: Gastrin
• Gene ID (NCBI): 2520
• RRID: AB_3084650
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01350
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Gastrin is a hormone produced primarily by G-cells in the stomach, where it functions to stimulate acid secretion by gastric parietal cells. Gastrin is a promiscuous hormone. Thus, the gastrin gene is expressed in common cancers such as bronchogenic, colorectal, ovarian and pancreatic carcinomas.