Tested Applications
| Positive IF-P detected in | human stomach cancer tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-60346 targets Gastrin in IF-P applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12795 Product name: Recombinant human GAST protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-101 aa of BC069724 Sequence: SEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN Predict reactive species |
| Full Name | gastrin |
| Calculated Molecular Weight | 101 aa, 11 kDa |
| GenBank Accession Number | BC069724 |
| Gene Symbol | Gastrin |
| Gene ID (NCBI) | 2520 |
| RRID | AB_3084650 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P01350 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Gastrin is a hormone produced primarily by G-cells in the stomach, where it functions to stimulate acid secretion by gastric parietal cells. Gastrin is a promiscuous hormone. Thus, the gastrin gene is expressed in common cancers such as bronchogenic, colorectal, ovarian and pancreatic carcinomas.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 Gastrin antibody CL594-60346 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



