Glutamate receptor 3/GluA3 Recombinant monoclonal antibody, PBS Only

Glutamate receptor 3/GluA3 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 84885-4-PBS
Clone No.242392C11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

GRIA3, 242392C11, GluA3, GluR 3, GLUR C

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84885-4-PBS targets Glutamate receptor 3/GluA3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag30898

Product name: Recombinant human GRIA3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 288-425 aa of NM_007325

Sequence: VRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASSENRTI

Predict reactive species
Full Name glutamate receptor, ionotrophic, AMPA 3
Calculated Molecular Weight 101 kDa
Observed Molecular Weight 101 kDa
GenBank Accession NumberNM_007325
Gene Symbol GRIA3
Gene ID (NCBI) 2892
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP42263
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. GRIA3 (Glutamate ionotropic receptor AMPA type subunit 3), also known as Glutamate receptor R3 or A3 (GluR3 or GluA3), is associated with X-linked intellectual disability (ID), dysmorphic features, and non-syndromic epilepsy(PMID: 32977175). GRIA3 also plays a role as a mediator of tumor progression in pancreatic cancer downstream CUX1(PMID: 20689760).

Loading...
||
New chat Able
正在加载,请稍候...