Glutamate receptor 3/GluA3 Recombinant monoclonal antibody

• 

  WB analysis using 84885-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84885-4-RR (Glutamate receptor 3/GluA3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 84885-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84885-4-RR (Glutamate receptor 3/GluA3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 84885-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84885-4-RR (Glutamate receptor 3/GluA3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 84885-4-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using Glutamate receptor 3/GluA3 antibody (84885-4-RR, Clone: 242392C11 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Glutamate receptor 3/GluA3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 84885-4-RR

Clone No.242392C11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

GRIA3, 242392C11, GluA3, GluR 3, GLUR C

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84885-4-RR targets Glutamate receptor 3/GluA3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30898

  Product name: Recombinant human GRIA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 288-425 aa of NM_007325

  Sequence: VRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASSENRTI

• Full Name: glutamate receptor, ionotrophic, AMPA 3
• Calculated Molecular Weight: 101 kDa
• Observed Molecular Weight: 101 kDa
• GenBank Accession Number: NM_007325
• Gene Symbol: GRIA3
• Gene ID (NCBI): 2892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P42263
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. GRIA3 (Glutamate ionotropic receptor AMPA type subunit 3), also known as Glutamate receptor R3 or A3 (GluR3 or GluA3), is associated with X-linked intellectual disability (ID), dysmorphic features, and non-syndromic epilepsy(PMID: 32977175). GRIA3 also plays a role as a mediator of tumor progression in pancreatic cancer downstream CUX1(PMID: 20689760).