TIM3 Monoclonal antibody

TIM3 Monoclonal Antibody for WB, ELISA
Cat No. 60355-1-Ig
Clone No.4C4G3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF, ELISA

4C4G3, CD366, HAVCR2, HAVcr-2, T-cell immunoglobulin and mucin domain-containing protein 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inDaudi cells, PC-3 cells, pig thymus tissue, ROS1728 cells, human heart tissue, RAW 264.7 cells, rat heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60355-1-Ig targets TIM3 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16901

Product name: Recombinant human HAVCR2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-142 aa of BC020843

Sequence: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPGEWTFACHLYE

Predict reactive species
Full Name hepatitis A virus cellular receptor 2
Calculated Molecular Weight 301 aa, 33 kDa
Observed Molecular Weight 33 kDa, 50-70 kDa
GenBank Accession NumberBC020843
Gene Symbol TIM3
Gene ID (NCBI) 84868
RRIDAB_2881464
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8TDQ0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TIM3, also known as HAVCR2, is a member of the recently discovered T cell Ig and mucin domain-containing molecule superfamily. TIM3 is a negative regulatory molecule that is important for T cell tolerance and has a crucial role in autoimmunity and T cell exhaustion during chronic viral infection (PMID: 23180819). TIM3 is expressed by T-helper type 1 (Th1) cells, macrophage, monocyte, dendritic cells, CD8+ T cell and other lymphocyte subsets. Galectin-9 is a ligand for TIM3. TIM3-galectin-9 pathway negatively regulates T helper type 1 immunity (PMID: 16286920). TIM3 is a 280-aa membrane protein with a calculated molecular weight of 33 kDa, the higher molecular weights between 50 and 70 kDa detected by this monoclonal antibody probably represent glycosylated TIM3 (PMID: 20107545; 17069754; 11725301).

Protocols

Product Specific Protocols
WB protocol for TIM3 antibody 60355-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human

EBioMedicine

Immunological profiles of human oligodendrogliomas define two distinct molecular subtypes

Authors - Fan Wu
humanWB

Oncogene

Tumor cell-intrinsic Tim-3 promotes liver cancer via NF-κB/IL-6/STAT3 axis.

Authors - Hualin Zhang
ratWB

Ecotoxicol Environ Saf

Expression levels of key immune indicators and immune checkpoints in manganese-exposed rats

Authors - Yuanmeng Qi
human

J Pathol

Molecular subtyping reveals immune alterations in IDH wild-type lower-grade diffuse glioma.

Authors - Fan Wu
human

Front Cell Dev Biol

Aberrantly Expressed Galectin-9 Is Involved in the Immunopathogenesis of Anti-MDA5-Positive Dermatomyositis-Associated Interstitial Lung Disease.

Authors - Lin Liang
pig

Front Immunol

Up-Regulation of Immune Checkpoints in the Thymus of PRRSV-1-Infected Piglets in a Virulence-Dependent Fashion.

Authors - Inés Ruedas-Torres

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Santhosh (Verified Customer) (04-15-2019)

Human Tonsil FFPE tissue. Heat mediated antigen retrieval (pH 6)

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:200
TIM3 Antibody Immunohistochemistry, validation (1:200 dilution) in (Cat no:60355-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...