Tested Applications
| Positive WB detected in | Daudi cells, PC-3 cells, pig thymus tissue, ROS1728 cells, human heart tissue, RAW 264.7 cells, rat heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 11 publications below |
| IF | See 3 publications below |
Product Information
60355-1-Ig targets TIM3 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16901 Product name: Recombinant human HAVCR2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-142 aa of BC020843 Sequence: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPGEWTFACHLYE Predict reactive species |
| Full Name | hepatitis A virus cellular receptor 2 |
| Calculated Molecular Weight | 301 aa, 33 kDa |
| Observed Molecular Weight | 33 kDa, 50-70 kDa |
| GenBank Accession Number | BC020843 |
| Gene Symbol | TIM3 |
| Gene ID (NCBI) | 84868 |
| RRID | AB_2881464 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q8TDQ0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TIM3, also known as HAVCR2, is a member of the recently discovered T cell Ig and mucin domain-containing molecule superfamily. TIM3 is a negative regulatory molecule that is important for T cell tolerance and has a crucial role in autoimmunity and T cell exhaustion during chronic viral infection (PMID: 23180819). TIM3 is expressed by T-helper type 1 (Th1) cells, macrophage, monocyte, dendritic cells, CD8+ T cell and other lymphocyte subsets. Galectin-9 is a ligand for TIM3. TIM3-galectin-9 pathway negatively regulates T helper type 1 immunity (PMID: 16286920). TIM3 is a 280-aa membrane protein with a calculated molecular weight of 33 kDa, the higher molecular weights between 50 and 70 kDa detected by this monoclonal antibody probably represent glycosylated TIM3 (PMID: 20107545; 17069754; 11725301).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TIM3 antibody 60355-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
EBioMedicine Immunological profiles of human oligodendrogliomas define two distinct molecular subtypes | ||
Ecotoxicol Environ Saf Expression levels of key immune indicators and immune checkpoints in manganese-exposed rats | ||
J Pathol Molecular subtyping reveals immune alterations in IDH wild-type lower-grade diffuse glioma. | ||
Front Cell Dev Biol Aberrantly Expressed Galectin-9 Is Involved in the Immunopathogenesis of Anti-MDA5-Positive Dermatomyositis-Associated Interstitial Lung Disease. | ||
Front Immunol Up-Regulation of Immune Checkpoints in the Thymus of PRRSV-1-Infected Piglets in a Virulence-Dependent Fashion. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Santhosh (Verified Customer) (04-15-2019) | Human Tonsil FFPE tissue. Heat mediated antigen retrieval (pH 6)
![]() |














