TIM3 Monoclonal antibody, PBS Only

• 

  WB analysis of Daudi using 60355-1-Ig (same clone as 60355-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 60355-1-Ig (TIM3 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60355-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig thymus using 60355-1-Ig (same clone as 60355-1-PBS)

  pig thymus tissue were subjected to SDS PAGE followed by western blot with 60355-1-Ig (TIM3 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60355-1-PBS in a different storage buffer formulation.

• 

  WB analysis of ROS1728 using 60355-1-Ig (same clone as 60355-1-PBS)

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 60355-1-Ig (TIM3 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60355-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 60355-1-Ig (same clone as 60355-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 60355-1-Ig (TIM3 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60355-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 60355-1-Ig (same clone as 60355-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 60355-1-Ig (TIM3 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60355-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 60355-1-Ig (same clone as 60355-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 60355-1-Ig (TIM3 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60355-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 60355-1-Ig (same clone as 60355-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 60355-1-Ig (TIM3 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60355-1-PBS in a different storage buffer formulation.

TIM3 Monoclonal Antibody for WB, ELISA

Cat No. 60355-1-PBS

Clone No.4C4G3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, ELISA

Synonyms

4C4G3, CD366, HAVCR2, HAVcr-2, T-cell immunoglobulin and mucin domain-containing protein 3

---

Product Information

60355-1-PBS targets TIM3 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16901

  Product name: Recombinant human HAVCR2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-142 aa of BC020843

  Sequence: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPGEWTFACHLYE

• Full Name: hepatitis A virus cellular receptor 2
• Calculated Molecular Weight: 301 aa, 33 kDa
• Observed Molecular Weight: 33 kDa, 50-70 kDa
• GenBank Accession Number: BC020843
• Gene Symbol: TIM3
• Gene ID (NCBI): 84868
• RRID: AB_2881464
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8TDQ0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TIM3, also known as HAVCR2, is a member of the recently discovered T cell Ig and mucin domain-containing molecule superfamily. TIM3 is a negative regulatory molecule that is important for T cell tolerance and has a crucial role in autoimmunity and T cell exhaustion during chronic viral infection (PMID: 23180819). TIM3 is expressed by T-helper type 1 (Th1) cells, macrophage, monocyte, dendritic cells, CD8+ T cell and other lymphocyte subsets. Galectin-9 is a ligand for TIM3. TIM3-galectin-9 pathway negatively regulates T helper type 1 immunity (PMID: 16286920). TIM3 is a 280-aa membrane protein with a calculated molecular weight of 33 kDa, the higher molecular weights between 50 and 70 kDa detected by this monoclonal antibody probably represent glycosylated TIM3 (PMID: 20107545; 17069754; 11725301).