Tested Applications
| Positive WB detected in | human placenta tissue, K-562 cells, mouse placenta tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human placenta tissue |
| Positive FC (Intra) detected in | K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12361-1-AP targets Hemoglobin Epsilon in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3026 Product name: Recombinant human HBE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC015537 Sequence: MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYH Predict reactive species |
| Full Name | hemoglobin, epsilon 1 |
| Calculated Molecular Weight | 147 aa, 16 kDa |
| Observed Molecular Weight | 12-16 kDa |
| GenBank Accession Number | BC015537 |
| Gene Symbol | HBE1 |
| Gene ID (NCBI) | 3046 |
| RRID | AB_2114593 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02100 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The hemoglobin molecule is a tetramer consisting of two alpha- and two beta-globin-like chains. HBE1 (hemoglobin epsilon chain) is a beta-type chain of hemoglobin predominantly expressed during the embryonic stage (21321359). The HBE1 has been regarded as the best marker for fetal nucleated red blood cells (NRBCs) . This antibody can be used to label and isolate fetal cells from maternal blood and may be useful in prenatal diagnosis (15906407).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Hemoglobin Epsilon antibody 12361-1-AP | Download protocol |
| IF protocol for Hemoglobin Epsilon antibody 12361-1-AP | Download protocol |
| IHC protocol for Hemoglobin Epsilon antibody 12361-1-AP | Download protocol |
| WB protocol for Hemoglobin Epsilon antibody 12361-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MCL-1 antibody (Cat# 12361-1-AP) has 9 total citations published in journals including Blood, Science Advances, Cell Death & Differentiation, BBA Molecular Cell Research, Molecular Cell Biology, Proteome Science, and bioRxiv. Research fields span erythropoiesis, hematopoietic progenitor lineage commitment, globin gene regulation, microRNA-mediated transcriptional control, chronic myeloid leukemia (CML), alternative splicing, and proteomics. Applications include Western blotting and immunohistochemistry across human, mouse, and rat species.
| Species | Application | Title |
|---|---|---|
Blood NFI-A directs the fate of hematopoietic progenitors to the erythroid or granulocytic lineage and controls beta-globin and G-CSF receptor expression. | ||
Sci Adv Transcriptional readthrough precedes alternative splicing programs triggered in CML cells by imatinib. | ||
Cell Death Differ Transcriptional fine-tuning of microRNA-223 levels directs lineage choice of human hematopoietic progenitors. | ||
Biochim Biophys Acta Mol Cell Res Long noncoding RNA CCDC26 as a modulator of transcriptional switching between fetal and embryonic globins. | ||
Mol Cell Biol A Feedback Loop Consisting of MicroRNA 23a/27a and the β-Like Globin Suppressors KLF3 and SP1 Regulates Globin Gene Expression. |

















