Hemoglobin Epsilon Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Hemoglobin Epsilon Polyclonal antibody (12361-1-AP)

Hemoglobin Epsilon Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 12361-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), ELISA

Synonyms

HBE1, Epsilon globin, Epsilon-globin, HBE, Hemoglobin epsilon chain

• 

  WB analysis of human placenta using 12361-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 12361-1-AP (Hemoglobin epsilon antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 12361-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 12361-1-AP (Hemoglobin epsilon antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse placenta using 12361-1-AP

  mouse placenta tissue were subjected to SDS PAGE followed by western blot with 12361-1-AP (Hemoglobin epsilon antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 12361-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 12361-1-AP (Hemoglobin epsilon antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 12361-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 12361-1-AP (Hemoglobin epsilon antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 12361-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 12361-1-AP (Hemoglobin epsilon antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human placenta using 12361-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using Hemoglobin Epsilon antibody (12361-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human placenta using 12361-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using Hemoglobin Epsilon antibody (12361-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of K-562 using 12361-1-AP

  1x10^6 K-562 cells were intracellularly stained with 0.4 ug Anti-Human Hemoglobin Epsilon (12361-1-AP)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Hemoglobin Epsilon in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human placenta tissue, K-562 cells, mouse placenta tissue
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human placenta tissue
• Positive FC (Intra) detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 ul suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12361-1-AP targets Hemoglobin Epsilon in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3026

  Product name: Recombinant human HBE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC015537

  Sequence: MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYH

• Full Name: hemoglobin, epsilon 1
• Calculated Molecular Weight: 147 aa, 16 kDa
• Observed Molecular Weight: 12-16 kDa
• GenBank Accession Number: BC015537
• Gene Symbol: HBE1
• Gene ID (NCBI): 3046
• RRID: AB_2114593
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02100
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The hemoglobin molecule is a tetramer consisting of two alpha- and two beta-globin-like chains. HBE1 (hemoglobin epsilon chain) is a beta-type chain of hemoglobin predominantly expressed during the embryonic stage (21321359). The HBE1 has been regarded as the best marker for fetal nucleated red blood cells (NRBCs) . This antibody can be used to label and isolate fetal cells from maternal blood and may be useful in prenatal diagnosis (15906407).

Publications

What published studies show

The Hemoglobin Epsilon Polyclonal antibody (catalog #12361-1-AP) has 9 citations. These appear in journals including Blood, Science Advances, Cell Death & Differentiation, Biochimica et Biophysica Acta, Molecular Cell Biology, Proteome Science, and bioRxiv. Research fields span erythropoiesis, hematopoietic progenitor lineage determination, globin gene expression regulation, chronic myeloid leukemia (CML), and serum proteomics, with applications mainly in Western blot and IHC.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Blood; NFI-A directs the fate of hematopoietic progenitors to the erythroid or granulocytic lineage and controls beta-globin and G-CSF receptor expression.; Authors - Linda Marie Starnes
mouse	IHC	Blood; Requirement for antiapoptotic MCL-1 during early erythropoiesis; Authors - Meghan E Turnis
human	WB	Sci Adv; Transcriptional readthrough precedes alternative splicing programs triggered in CML cells by imatinib.; Authors - Paulina Podszywałow-Bartnicka
human	WB	Cell Death Differ; Transcriptional fine-tuning of microRNA-223 levels directs lineage choice of human hematopoietic progenitors.; Authors - L Vian
human	WB	Biochim Biophys Acta Mol Cell Res; Long noncoding RNA CCDC26 as a modulator of transcriptional switching between fetal and embryonic globins.; Authors - Tetsuo Hirano
human	WB	Mol Cell Biol; A Feedback Loop Consisting of MicroRNA 23a/27a and the β-Like Globin Suppressors KLF3 and SP1 Regulates Globin Gene Expression.; Authors - Ma Yanni Y