CoraLite® Plus 488-conjugated Hemoglobin Epsilon Polyclonal antibody

Hemoglobin Epsilon Polyclonal Antibody for IF-P, FC (Intra)
Cat No. CL488-12361

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra)

HBE1, Epsilon globin, Epsilon-globin, HBE, Hemoglobin epsilon chain

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman placenta tissue
Positive FC (Intra) detected inK-562 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-12361 targets Hemoglobin Epsilon in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3026

Product name: Recombinant human HBE1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-147 aa of BC015537

Sequence: MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYH

Predict reactive species
Full Name hemoglobin, epsilon 1
Calculated Molecular Weight 147 aa, 16 kDa
Observed Molecular Weight 12-16 kDa
GenBank Accession NumberBC015537
Gene Symbol HBE1
Gene ID (NCBI) 3046
RRIDAB_2919051
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02100
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The hemoglobin molecule is a tetramer consisting of two alpha- and two beta-globin-like chains. HBE1 (hemoglobin epsilon chain) is a beta-type chain of hemoglobin predominantly expressed during the embryonic stage (21321359). The HBE1 has been regarded as the best marker for fetal nucleated red blood cells (NRBCs) . This antibody can be used to label and isolate fetal cells from maternal blood and may be useful in prenatal diagnosis (15906407).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Hemoglobin Epsilon antibody CL488-12361Download protocol
IF protocol for CL Plus 488 Hemoglobin Epsilon antibody CL488-12361Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...