HCRTR1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of C6 using 82921-1-RR (same clone as 82921-1-PBS)

  C6 cells were subjected to SDS PAGE followed by western blot with 82921-1-RR (HCRTR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82921-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82921-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82921-1-RR against Human HCRTR1 were performed. The affinity constant is below 1 pM.

HCRTR1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 82921-1-PBS

Clone No.1E18

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

Orexin receptor 1, Ox 1 R, Orexin/Hypocretin receptor type 1, Orexin receptor type 1, Hypocretin receptor type 1

---

Product Information

82921-1-PBS targets HCRTR1 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12269

  Product name: Recombinant human HCRTR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 321-425 aa of BC074796

  Sequence: KRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP

• Full Name: hypocretin (orexin) receptor 1
• Calculated Molecular Weight: 425 aa, 48 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC074796
• Gene Symbol: HCRTR1
• Gene ID (NCBI): 3061
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43613
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The hypocretin receptor 1 (OX1R, also named HCRTR1) is a G protein-coupled receptor and is a critical participant in the regulation of motivated behavior (PMID:28971565). HCRTR1 is associated with the regulation of motivation, reward, and autonomic functions. HCRTR1 shows a selective binding affinity for HCRT1/orexin-A. Moreover, HCRTR1 and HCRTR2 share 64% sequence similarity in humans (PMID:34052813).