HCRTR2 Polyclonal antibody

• 

  WB analysis using 32859-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32859-1-AP (HCRTR2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

HCRTR2 Polyclonal Antibody for WB, ELISA

Cat No. 32859-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Hypocretin receptor type 2, Orexin receptor type 2, Ox2R, Ox-2-R, Ox2-R

---

Tested Applications

• Positive WB detected in: C6 cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32859-1-AP targets HCRTR2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38128

  Product name: Recombinant human HCRTR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 380-444 aa of NM_001526

  Sequence: SCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW

• Full Name: hypocretin (orexin) receptor 2
• Calculated Molecular Weight: 440aa, 51 kDa
• Observed Molecular Weight: 70-73 kDa
• GenBank Accession Number: NM_001526
• Gene Symbol: HCRTR2
• Gene ID (NCBI): 3062
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O43614
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.