HDAC1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83624-1-RR (same clone as 83624-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83624-1-RR (HDAC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83624-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 83624-1-RR (same clone as 83624-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 83624-1-RR (HDAC1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83624-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 83624-1-RR (same clone as 83624-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HDAC1 antibody (83624-1-RR, Clone: 240614A3 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83624-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 83624-1-RR (same clone as 83624-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HDAC1 antibody (83624-1-RR, Clone: 240614A3 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83624-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83624-1-RR (same clone as 83624-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug HDAC1 Recombinant antibody (83624-1-RR, Clone:240614A3) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83624-1-PBS in a different storage buffer formulation.

• 

  ChIP experiment of K-562 using 83624-1-RR (same clone as 83624-1-PBS)

  Chromatin was prepared from K-562 cells. Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 20 µg of cross-linked chromatin, 5 µg of HDAC1 (83624-1-RR) or 5 ug of Normal Rabbit IgG (98136-1-RR), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR. This data was developed using the same antibody clone with 83624-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83624-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 83624-1-PBS against Human HDAC1 was performed. The affinity constant is below 1 pM.

• 

  Affinity and Kinetic Characterization of 83624-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83624-1-RR against Human HDAC1 were performed. The affinity constant is below 1 pM.

HDAC1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR

Cat No. 83624-1-PBS

Clone No.240614A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR

Synonyms

240614A3, EC:3.5.1.-, EC:3.5.1.98, GON 10, HD1

---

Product Information

83624-1-PBS targets HDAC1 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0256

  Product name: Recombinant human HDAC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 184-482 aa of BC000301

  Sequence: EEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

• Full Name: histone deacetylase 1
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 58-66 kDa
• GenBank Accession Number: BC000301
• Gene Symbol: HDAC1
• Gene ID (NCBI): 3065
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13547
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Histone deacetylases(HDAC) are a class of enzymes that remove the acetyl groups from the lysine residues leading to the formation of a condensed and transcriptionally silenced chromatin. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex, which is responsible for gene expression silencing. It also plays an important role in the control of cell proliferation and differentiation by interacting with RB, p53 and other transcription factors. At least 4 classes of HDAC were identified. As a class I HDAC, HDAC 1 was primarily found in the nucleus.